Transcript | Ll_transcript_310831 |
---|---|
CDS coordinates | 285-872 (+) |
Peptide sequence | MINLFVFVYDSGRIRIPYVFLTNGGGFPEAKRAFELSQLLGINVSASQVLQGHSPFKQLVNRFENEFIVAVGKGQPAAVMSEYGFKNVLSIDEYASLFENIDPLAPYKKWTTKLAAVQNAEFNEGAPRNDVFSERVKAAFVVSDPVDWSRDIQVLCDILKTGGLPGRNVGPQPHLYFANDDLEYQVPKKLDRFSF* |
ORF Type | complete |
Blastp | Uncharacterized protein YKR070W from Saccharomyces with 34.22% of identity |
---|---|
Blastx | Uncharacterized protein YKR070W from Saccharomyces with 33.84% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (YKR070W) |
CantataDB | Link to cantataDB annotations (CNT0002221) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019447918.1) |
Pfam | Haloacid dehalogenase-like hydrolase (PF13344.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer