Protein coding transcript 3574

• Transcript: Ll_transcript_400102
• CDS coordinates: 2-502 (+)
• Peptide sequence: IDCVPVAKMNLLKLAPGGHVGRFIIWTESAFKELDKLYGTWKSSSKVKKGYNLPMPKMGNTDLTRLLKSEEIRKVLRPAVTKVIRRVKKHNPLSNQRAMLKLNPYAAVLKRNAILTMQRRMKAKADLIAKKRGETVEPPVRDARTVKPRKKVVKKRTPEERKALKAK
• ORF Type: internal

Annotations of Ll_transcript_400102

• Blastp: 60S ribosomal protein L4 from Sophophora with 62.04% of identity
• Blastx: 60S ribosomal protein L4 from Sophophora with 62.04% of identity
• Eggnog: One of the primary rRNA binding proteins, this protein initially binds near the 5'-end of the 23S rRNA. It is important during the early stages of 50S assembly. It makes multiple contacts with different domains of the 23S rRNA in the assembled 50S subunit and ribosome (By similarity)(COG0088)
• Kegg: Link to kegg annotations (Dmel_CG5502)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_006577005.1)
• Pfam: 60S ribosomal protein L4 C-terminal domain (PF14374.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;