Protein coding transcript 35767

• Transcript: Ll_transcript_310935
• CDS coordinates: 961-1377 (+)
• Peptide sequence: MRKKAQEEKRAAASPTSSSCQSSLSISNNNNHTVNSVHASKKAGEESFYDTGGPNNKESASNGNINVGEDHQNGEQGYSMDDIWKDISMLEDNILPSTSWEYSSEPLWMMDEEESKMLFPLSDQCFSCYEHGSAFLTG*
• ORF Type: complete

Annotations of Ll_transcript_310935

• Blastp: Transcription factor MYB48 from Arabidopsis with 36.6% of identity
• Blastx: Transcription factor MYB59 from Arabidopsis with 61.54% of identity
• Eggnog: Myblike DNAbinding domain containing protein(COG5147)
• Kegg: Link to kegg annotations (AT3G46130)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448660.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;