Protein coding transcript 35768

• Transcript: Ll_transcript_310939
• CDS coordinates: 2-796 (+)
• Peptide sequence: HNSRKLTFHFQNLAQEHRSKMVQEAMKKGPWTEQEDFKLVYYVGLFGDRKWDHIAKVSGLNRTGKSCRLRWVNYLHPGLKRGKMTPQEEKLVLELHSKWGNRWSRIARKLPGRTDNEIKNYWRTHMRKMAQENKRAPIPSLTSSGCHSSISSSSNHAVDSHASKNAGGEECIYDTGGPNLKDLSSEVNIVDDQEGFSMDDIWKDIDMSEENILQPNYDYGYHFSCPSRECCLDPLWVMDEESMLFPTSDPYFSCYIHGSTFLTG*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_310939

• Blastp: Transcription factor MYB48 from Arabidopsis with 54.33% of identity
• Blastx: Transcription factor MYB48 from Arabidopsis with 54.33% of identity
• Eggnog: Myblike DNAbinding domain containing protein(COG5147)
• Kegg: Link to kegg annotations (AT3G46130)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447931.1)
• Pfam: Myb-like DNA-binding domain (PF00249.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;