Protein coding transcript 35774

• Transcript: Ll_transcript_310922
• CDS coordinates: 369-1169 (+)
• Peptide sequence: MGRSPCGSKDGLNKGAWTPHEDIILIEYIKLLGEGRWENVPKRAGLKRCGKSCRLRWLNYLRPNIKRGNISSDEEDLIIRLHNLLGNRWSVIAGRLPGRTDNEIKNYWNSHLGKKVKDSHQITTVSSLSRSAQPNAKSTENPKPELNPKVKAIASPSSLMLDTNVVLKKANKYSSVLIKNPLLQSSMQLQNMFKLKGAVSSNDSISDRMDPSDNNGSLSFVNEEEKELSTDLLKDFMVGGDNYSPDLLNDSDFSNMCDFSHNDNNNE
• ORF Type: 3prime_partial

Annotations of Ll_transcript_310922

• Blastp: Anthocyanin regulatory C1 protein from Zea with 75% of identity
• Blastx: Anthocyanin regulatory C1 protein from Zea with 75% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (541757)
• CantataDB: Link to cantataDB annotations (CNT0000269)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436210.1)
• Pfam: Myb-like DNA-binding domain (PF00249.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;