Transcript | Ll_transcript_310937 |
---|---|
CDS coordinates | 613-1302 (+) |
Peptide sequence | MWLGVLSGLKRCGKSCRLRWLNYLRPNIKRGNISSDEEDLIIRLHNLLGNRWSVIAGRLPGRTDNEIKNYWNSHLGKKVKDSHQITTVSSLSRSAQPNAKSTENPKPELNPKVKAIASPSSLMLDTNVVLKKANKYSSVLIKNPLLQSSMQLQNMFKLKGAVSSNDSISDRMDPSDNNGSLSFVNEEEKELSTDLLKDFMVGGDNYSPDLLNDSDFSNMCDFSHNDNNNE |
ORF Type | 3prime_partial |
Blastp | Transcription factor TT2 from Arabidopsis with 55.07% of identity |
---|---|
Blastx | Anthocyanin regulatory C1 protein from Zea with 89.86% of identity |
Eggnog | Myblike DNAbinding domain containing protein(COG5147) |
Kegg | Link to kegg annotations (AT5G35550) |
CantataDB | Link to cantataDB annotations (CNT0000269) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019436210.1) |
Pfam | Myb-like DNA-binding domain (PF00249.30) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer