Protein coding transcript 358

• Transcript: Ll_transcript_513827
• CDS coordinates: 31-423 (+)
• Peptide sequence: MAATSIKIVKKRTKPFKRHQSDRYHGVKEAWRKPKGIDNRVRRRFKGQLPMPSIGYGSNKKTRHVLPSGYKKFLVNNERDVELLLMNNKGYAAEIAHGVSARKRVAIVEKAKVLGVKVTNSQAKVRTEEA*
• ORF Type: complete

Annotations of Ll_transcript_513827

• Blastp: 60S ribosomal protein L32 from Neurospora with 72.36% of identity
• Blastx: 60S ribosomal protein L32 from Neurospora with 72.36% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (NCU00464)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004492257.1)
• Pfam: Ribosomal protein L32 (PF01655.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;