| Transcript | Ll_transcript_309187 |
|---|---|
| CDS coordinates | 277-597 (+) |
| Peptide sequence | MAISKTLFSSFLICLVTLHFVESDTTMVINNNMVENPSPSPLPPTIDCDAACNGRCQLSSRPNLCNRACGSCCERCNCVPSGTSGNYEECLCYANITTHGGRHKCP* |
| ORF Type | complete |
| Blastp | Snakin-2 from Solanum with 56.6% of identity |
|---|---|
| Blastx | Snakin-2 from Solanum with 56.6% of identity |
| Eggnog | gast1 protein homolog 1(ENOG410YWQ9) |
| Kegg | Link to kegg annotations (102582131) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019457696.1) |
| Pfam | Gibberellin regulated protein (PF02704.13) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer