Protein coding transcript 35843

• Transcript: Ll_transcript_309084
• CDS coordinates: 162-959 (+)
• Peptide sequence: MDDYTREMMDLKTLVTRTLEKKGVLAKIRAELRASVFEAIEEEDRVIEKDEGLPPALLASCNDRAKHLHASPSGRLLTALICEYLDWAQLNHTLKVYLPECNLEKDSWKAELKEFSNKNGYDLNRNGDSPLLLDVLEGFLKFENLSQARVSGRRFTTSGTEPLPNSESRNMRRPSSSSVVGGLPPLGRAVPSSQGSDRRGGSSTSAYRKDEYNWRYDSDELPDDVIHASNALENLQLDRKARNLTSSWRHAGDGSSEDDGRADHV*
• ORF Type: complete

Annotations of Ll_transcript_309084

• Blastp: Protein TONNEAU 1b from Arabidopsis with 70.77% of identity
• Blastx: Protein TONNEAU 1b from Arabidopsis with 69.23% of identity
• Eggnog: Tonneau 1b(ENOG410Y1GN)
• Kegg: Link to kegg annotations (AT3G55005)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451095.1)
• Pfam: LisH (PF16045.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;