Transcript | Ll_transcript_309086 |
---|---|
CDS coordinates | 142-636 (+) |
Peptide sequence | MDDYTREMMDLKTLVTRTLEKKGVLARIRAELRASVFEAIEEEDRVIEKDEGLPPALLASCNDRAKHLHASPSGRLLTALVCEYLDWAQLNHTLKVYLPECNLEKDSWKAELKESSSKNGLDLNRNGDSPLLLGVLEGFLKFEVFQLLGFFMSFFHPLPYFLFR* |
ORF Type | complete |
Blastp | Protein TONNEAU 1b from Arabidopsis with 81.46% of identity |
---|---|
Blastx | Protein TONNEAU 1b from Arabidopsis with 81.46% of identity |
Eggnog | Tonneau 1b(ENOG410Y1GN) |
Kegg | Link to kegg annotations (AT3G55005) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019426651.1) |
Pfam | LisH (PF16045.4) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer