Protein coding transcript 35856

• Transcript: Ll_transcript_310153
• CDS coordinates: 255-1334 (+)
• Peptide sequence: MAKTFKYIILGGGVSAGYAAREFSKQGLKPGELAIISKEAVAPYERPALSKAYLFPESPARLPGFHVCVGSGGERLLPEWYTEKGIELILSTEIVKADITTKSLTSAGGETFNYQTLIIATGSTVIRLTDFGVQGADAKNIFYLREIEDADKLYEAIKAKKNGKAVIVGGGYIGLELSAVLKLNNVDVNMVYPEPWCMPRLFTSDIAHFYEGYYANKGVKIIKGTVATGFTANSDGEVKEVKLKDGRVLEADIVVVGVGGRPLTTLFKGQVAEEKGGIKTDSFFKTSIPSVYAVGDVATFPLKLYGELRRVEHVDHSRKSAEQAVKVSIFVKYLSFSNYAKNSNEPLPGNSRLNMTSMF*
• ORF Type: complete

Annotations of Ll_transcript_310153

• Blastp: Monodehydroascorbate reductase from Lycopersicon with 84.26% of identity
• Blastx: Monodehydroascorbate reductase from Lycopersicon with 84.26% of identity
• Eggnog: pyridine nucleotide-disulfide oxidoreductase(COG0446)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444265.1)
• Pfam: Pyridine nucleotide-disulphide oxidoreductase (PF07992.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;