Transcript | Ll_transcript_310160 |
---|---|
CDS coordinates | 832-1308 (+) |
Peptide sequence | MVYPEPWCMPRLFTSDIAAFYEGYYANKGVNIIKGTVAVGFNANSDGEVKEVKLKDGRVLEADIVVVGVGGRPLVSLFKGQVEEEKGGIKTDSSFKTNVSGVYAVGDVATFPLKLYGELRRVEHVDHARKSAEQAVKAIKAAEDGKTVEQYEYLPYFYS |
ORF Type | 3prime_partial |
Blastp | Monodehydroascorbate reductase from Pisum with 86.16% of identity |
---|---|
Blastx | Monodehydroascorbate reductase from Pisum with 86.16% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019428207.1) |
Pfam | Pyridine nucleotide-disulphide oxidoreductase (PF07992.13) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer