Protein coding transcript 35861

• Transcript: Ll_transcript_310160
• CDS coordinates: 832-1308 (+)
• Peptide sequence: MVYPEPWCMPRLFTSDIAAFYEGYYANKGVNIIKGTVAVGFNANSDGEVKEVKLKDGRVLEADIVVVGVGGRPLVSLFKGQVEEEKGGIKTDSSFKTNVSGVYAVGDVATFPLKLYGELRRVEHVDHARKSAEQAVKAIKAAEDGKTVEQYEYLPYFYS
• ORF Type: 3prime_partial

Annotations of Ll_transcript_310160

• Blastp: Monodehydroascorbate reductase from Pisum with 86.16% of identity
• Blastx: Monodehydroascorbate reductase from Pisum with 86.16% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428207.1)
• Pfam: Pyridine nucleotide-disulphide oxidoreductase (PF07992.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;