Transcript | Ll_transcript_309629 |
---|---|
CDS coordinates | 190-879 (+) |
Peptide sequence | MAFEHYFSDERKSESIPNAVTETENYNGCFDCNICLDFAYEPVVTLCGHLYCWPCIYKWLHVQSDSLAADEHPQCPVCKADISHTTMVPLYGRGQASSQSHHVGKSSTCCDIFIPPRPSASSAEALLGTSSQTGQQLPYRNPYQGHGEEDSSPQLLNPGYQNPMVGMLGEMVYARVFGNSENLYAYPNSYQLMGSNSPSLRQQEMLIDKSLNRILIFLFCCFVLCLIVF* |
ORF Type | complete |
Blastp | E3 ubiquitin-protein ligase RMA1H1 from Capsicum with 49.1% of identity |
---|---|
Blastx | E3 ubiquitin-protein ligase RMA1H1 from Capsicum with 47.09% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (107855034) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019435392.1) |
Pfam | Ring finger domain (PF13639.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer