Protein coding transcript 35872

• Transcript: Ll_transcript_309630
• CDS coordinates: 1148-1837 (+)
• Peptide sequence: MAFEHYFSDERKSESIPNAVTETENYNGCFDCNICLDFAYEPVVTLCGHLYCWPCIYKWLHVQSDSLAADEHPQCPVCKADISHTTMVPLYGRGQASSQSHHVGKSSTCCDIFIPPRPSASSAEALLGTSSQTGQQLPYRNPYQGHGEEDSSPQLLNPGYQNPMVGMLGEMVYARVFGNSENLYAYPNSYQLMGSNSPSLRQQEMLIDKSLNRILIFLFCCFVLCLIVF*
• ORF Type: complete

Annotations of Ll_transcript_309630

• Blastp: E3 ubiquitin-protein ligase RMA1H1 from Capsicum with 49.1% of identity
• Blastx: E3 ubiquitin-protein ligase RMA1H1 from Capsicum with 47.09% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (107855034)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019435392.1)
• Pfam: Ring finger domain (PF13639.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;