| Transcript | Ll_transcript_309640 |
|---|---|
| CDS coordinates | 329-637 (+) |
| Peptide sequence | MEHQHRDITKHVTHNMVETEESVVAEDIGREKLKRHRVEVAGNVWVPEIWGQEEFLKDWIDCTSAFDASLVHSRITTAQKALVEEGRKVDNVIAGISIENRC* |
| ORF Type | complete |
| Blastp | Protein BIC1 from Arabidopsis with 59.21% of identity |
|---|---|
| Blastx | Protein BIC1 from Arabidopsis with 59.21% of identity |
| Eggnog | NA(ENOG410YZXR) |
| Kegg | Link to kegg annotations (AT3G52740) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019432920.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer