Protein coding transcript 359

• Transcript: Ll_transcript_513828
• CDS coordinates: 57-527 (+)
• Peptide sequence: MNTQKHARNLHSLSNMISLKRLITIARKWKRVAGIKRRVVISQPRNNHKVVAANKGHFVVYTIDKGRFVVPLCYLRSKIFRELFRISEEQFGLPTDGPITLPCDSAFMEYVVSLVRKRVSLELENMVQLVASFGFGSDCQCLALESGAVILSSIGM*
• ORF Type: complete

Annotations of Ll_transcript_513828

• Blastp: Auxin-responsive protein SAUR66 from Arabidopsis with 44.55% of identity
• Blastx: Auxin-responsive protein SAUR64 from Arabidopsis with 43.65% of identity
• Eggnog: Auxin-induced protein(ENOG410YP87)
• Kegg: Link to kegg annotations (AT1G29500)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450631.1)
• Pfam: Auxin responsive protein (PF02519.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;