Protein coding transcript 35912

• Transcript: Ll_transcript_308969
• CDS coordinates: 1-456 (+)
• Peptide sequence: KKWKCDKCSKCYAVQSDWKAHSKTCGTKEYKCDCGTIFSRRDSFITHRAFCDALAEETARVNATSNISNSLGPNFSYNIMGTPQVPNMATHFSSIFKPVSSINHETSNQTSRGLSLWMDQLSHHQAHETKVNENIHQLGSAPNSGPVQARL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_308969

• Blastp: Zinc finger protein NUTCRACKER from Arabidopsis with 56.2% of identity
• Blastx: Zinc finger protein NUTCRACKER from Arabidopsis with 56.2% of identity
• Eggnog: Zinc finger protein(COG5048)
• Kegg: Link to kegg annotations (AT5G44160)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464968.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;