Protein coding transcript 35917

• Transcript: Ll_transcript_308981
• CDS coordinates: 1-408 (+)
• Peptide sequence: GNPDPEADIIALSPKTLMATNRFLCETCGKGFQRDQNLQLHRRGHNLPWKLKQRTSTEIRKRVYVCPEKTCVHHNPARALGDLTGIKKHFCRKHGEKKWKCEKCSKKYAVQSDWKAHSKICGTREYKCDCGTFFSR
• ORF Type: internal

Annotations of Ll_transcript_308981

• Blastp: Protein indeterminate-domain 1 from Arabidopsis with 86.55% of identity
• Blastx: Zinc finger protein MAGPIE from Arabidopsis with 90.44% of identity
• Eggnog: Zinc finger protein(COG5048)
• Kegg: Link to kegg annotations (AT5G66730)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464968.1)
• Pfam: C2H2-type zinc finger (PF13912.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;