Protein coding transcript 35921

• Transcript: Ll_transcript_308978
• CDS coordinates: 3-884 (+)
• Peptide sequence: GLSSPQFPSLTPSLTAFYHRRTLSPPTPFTSDSNIIHPYFSKRVYNNMTETDNPSPSSMAASGEATFSSSSLENASQPPPKKKRSLPGMPDPDAEVIALSPTTLMATNRFVCEICKKGFQRDQNLQLHRRGHNLPWKLRQRSANDVRKKVYVCPEPSCVHHHASRALGDLTGIKKHFSRKHGEKKWKCERCSKQYAVQSDWKAHMKSCGTREYRCDCGTFFSRRDSFLTHRAFCDALAEEARAQTLTVASPSPPPPPLTPSTTVISPTLSIQSSGTSLAVFFFLNVFVNINLL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_308978

• Blastp: Protein indeterminate-domain 1 from Arabidopsis with 79.03% of identity
• Blastx: Protein indeterminate-domain 1 from Arabidopsis with 79.03% of identity
• Eggnog: Zinc finger protein(COG5048)
• Kegg: Link to kegg annotations (AT5G66730)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432499.1)
• Pfam: Zinc-finger of C2H2 type (PF12874.6)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;