Protein coding transcript 35937

• Transcript: Ll_transcript_310094
• CDS coordinates: 1964-2287 (+)
• Peptide sequence: MLGPGQTTDVLINGDNPPSLYYIASRAYQSAQNAAFDNTTTTAILQYKSTHHVLNVKKPLMPLLPAYNDTNTVTAFSRSFRSSRKVEVPIEIDENLFFTVGLGLNKCP
• ORF Type: 3prime_partial

Annotations of Ll_transcript_310094

• Blastp: Laccase-5 from Arabidopsis with 68.64% of identity
• Blastx: Laccase-5 from Arabidopsis with 70.95% of identity
• Eggnog: Multicopper oxidase(COG2132)
• Kegg: Link to kegg annotations (AT2G40370)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437574.1)
• Pfam: Multicopper oxidase (PF00394.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;