Protein coding transcript 35941

• Transcript: Ll_transcript_310096
• CDS coordinates: 141-449 (+)
• Peptide sequence: MEGLNTFLAIFVLLALALSSTNAKIQEHEFVVQATPVKRLCNTHSAITVNGQFPGPTLEVNNGDTLVVKVINKARYNVTIHWHGIRQMRTGWADGPEFVTQCP
• ORF Type: 3prime_partial

Annotations of Ll_transcript_310096

• Blastp: Laccase-12 from Arabidopsis with 68.27% of identity
• Blastx: Laccase-12 from Arabidopsis with 81.48% of identity
• Eggnog: Multicopper oxidase(COG2132)
• Kegg: Link to kegg annotations (AT5G05390)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433825.1)
• Pfam: Multicopper oxidase (PF07732.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;