| Transcript | Ll_transcript_400089 |
|---|---|
| CDS coordinates | 733-1140 (+) |
| Peptide sequence | MQKLGLVDNWFIYEGEVGNQRRRKMSNSCKSSETESPICCVKKHVNILQGNPNNVQAYVYRSDKQCVAFTIEGSYVHRTCKVLDECKRVVAEIKKKEANTKHVSFGMDIFQLVVQPGFDPAFAMALVLLLDQMFS* |
| ORF Type | complete |
| Blastp | Protein LURP-one-related 17 from Arabidopsis with 44.37% of identity |
|---|---|
| Blastx | Protein LURP-one-related 17 from Arabidopsis with 45.03% of identity |
| Eggnog | LURP-one-related 17-like(ENOG4111AYF) |
| Kegg | Link to kegg annotations (AT5G41590) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019421533.1) |
| Pfam | LURP-one-related (PF04525.11) |
| Rfam | - |
| GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer