Protein coding transcript 36028

• Transcript: Ll_transcript_311678
• CDS coordinates: 121-693 (+)
• Peptide sequence: MGTLGRVIYTVGFWIRETGQAVDRLGSRLQGSYYFQEQLSRHRTLMNIFDKAPTVDKDAFVAPSASVIGDVHIGKGSSIWYGSVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVIPTIIGNNVTIGHSAVLHGCTVDDEAFVGMGAILLDGVVVEKNAMVAAGALVRQNTRIPSGEVSLWVCAVWII*
• ORF Type: complete

Annotations of Ll_transcript_311678

• Blastp: Gamma carbonic anhydrase 1, mitochondrial from Arabidopsis with 87.22% of identity
• Blastx: Gamma carbonic anhydrase 1, mitochondrial from Arabidopsis with 87.22% of identity
• Eggnog: Transferase(COG0663)
• Kegg: Link to kegg annotations (AT1G19580)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432492.1)
• Pfam: Bacterial transferase hexapeptide (six repeats) (PF00132.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;