Transcript | Ll_transcript_311422 |
---|---|
CDS coordinates | 192-602 (+) |
Peptide sequence | MNNSSASTSSKPRAASSQPSETSSKRKRGVFQKELQHMMYGFGDDINPLPESVTLMEDIVVEYVTELVHKAQDIGSQRGKLSVEDFLYLIRKDNKKLNRCTELLSMNEELKQARKVFESDEEKLRKVFEVDETPAE* |
ORF Type | complete |
Blastp | Transcription initiation factor TFIID subunit 13 from Arabidopsis with 70% of identity |
---|---|
Blastx | Transcription initiation factor TFIID subunit 13 from Arabidopsis with 71.03% of identity |
Eggnog | TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor(COG5248) |
Kegg | Link to kegg annotations (AT1G02680) |
CantataDB | Link to cantataDB annotations (CNT0002486) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019415609.1) |
Pfam | Transcription initiation factor IID, 18kD subunit (PF02269.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer