Transcript | Ll_transcript_310480 |
---|---|
CDS coordinates | 1-885 (+) |
Peptide sequence | VALAAGSNITLLADQIKRFKPQLVSVKDESLIAELEEALNGIEHKPEIIPGEQGIIEVARHPDAVSVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAKKHNIKILPADSEHSAIFQCIQGLPEGALRKIILTASGGSFRDWPVEKLKDVKVADALKHPNWSMGKKITVDSATLFNKGLEVIEAHYLFGADYDDIEIVIHAQSIIHSMIETQDSSVLAQLGWPDMRLPILYTLSWPDRVHCSEVTWPRLDLCKLGSLTFKAPDNVKYPSMNLAYAAGRAGGTMT |
ORF Type | internal |
Blastp | 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic from Arabidopsis with 90.17% of identity |
---|---|
Blastx | 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic from Arabidopsis with 90.17% of identity |
Eggnog | Catalyzes the NADP-dependent rearrangement and reduction of 1-deoxy-D-xylulose-5-phosphate (DXP) to 2-C-methyl-D-erythritol 4-phosphate (MEP) (By similarity)(COG0743) |
Kegg | Link to kegg annotations (AT5G62790) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019463865.1) |
Pfam | 1-deoxy-D-xylulose 5-phosphate reductoisomerase (PF02670.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer