Transcript | Ll_transcript_310481 |
---|---|
CDS coordinates | 3-647 (+) |
Peptide sequence | IVAENPDKFRVVALAAGSNITLLADQIKRFKPQLVSVRDESLIAELEEALNGVEQKPEIIPGEQGIIEVARHPDAVSVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAKKHNIKILPADSEHSAIFQCIQGLPEGALRKIILTASGGSFRDWPVEKLKDVKVADALKHPNWSMGKKITVDSATLFNKGLEVIEAHYLFGADYD |
ORF Type | internal |
Blastp | 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic from Mentha with 90.23% of identity |
---|---|
Blastx | 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic from Arabidopsis with 89.3% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019463865.1) |
Pfam | 1-deoxy-D-xylulose 5-phosphate reductoisomerase (PF02670.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer