Transcript | Ll_transcript_310482 |
---|---|
CDS coordinates | 1-480 (+) |
Peptide sequence | VALAAGSNITLLADQIKRFKPQLVSVKDESLIAELEEALNGIEHKPEIIPGEQGIIEVARHPDAVSVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAKKHNIKILPADSEHSAIFQCIQGLPEGALRKIILTASGGSFRYAYTPMLY* |
ORF Type | 5prime_partial |
Blastp | 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic from Mentha with 90.07% of identity |
---|---|
Blastx | 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic from Mentha with 90.07% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019463865.1) |
Pfam | 1-deoxy-D-xylulose 5-phosphate reductoisomerase (PF02670.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer