Protein coding transcript 36120

• Transcript: Ll_transcript_310485
• CDS coordinates: 1-480 (+)
• Peptide sequence: VALAAGSNITLLADQIKRFKPQLVSVKDESLIAELEEALNGIEHKPEIIPGEQGIIEVARHPDAVTVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAKKHNIKILPADSEHSAIFQCIQGLPEGALRKIILTASGGSFRYAYTPMLY*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_310485

• Blastp: 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic from Mentha with 90.73% of identity
• Blastx: 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic from Mentha with 90.73% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463865.1)
• Pfam: 1-deoxy-D-xylulose 5-phosphate reductoisomerase (PF02670.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;