Transcript | Ll_transcript_309546 |
---|---|
CDS coordinates | 149-1180 (+) |
Peptide sequence | MAAFLNKTYAMVDDSATASVVSWGDNNTTFVVWNVPVFSTLILPQYFKHNNFSSFVRQLNTYGFRKIVPDRWEFANELFKKGEKHLLCEIHRRKTAQPQQVSTNHHHDSSLGINVPSFFPFTTRVSISPPYDSDEQPNWCDSPPLTSPMRGPPTSLINVDAANYNSSVTALSEDNERLRRNNNMLMSELAHMKKLYNDIIYFVQNHVKHVAPSNTYSPSSFLPCNAPQQQVASNVSMVQRPMNRLLGYYSTTTNPKQTFQHQPQAQAHIMNSPTNNSMGSVTVVEGRSSNTSKTKLFGVFLQSKKRVHPEYDSNFINSETNKTRLVLEKDDLGLNLMPPNSAY* |
ORF Type | complete |
Blastp | Heat stress transcription factor B-4 from Arabidopsis with 52.87% of identity |
---|---|
Blastx | Heat stress transcription factor B-4 from Arabidopsis with 52.86% of identity |
Eggnog | Transcription factor(COG5169) |
Kegg | Link to kegg annotations (AT1G46264) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019437965.1) |
Pfam | HSF-type DNA-binding (PF00447.16) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer