Protein coding transcript 36177

• Transcript: Ll_transcript_311390
• CDS coordinates: 2-655 (+)
• Peptide sequence: SYRLSYERFQHDFLFFISLSLSLHLHPTTIPIHSYSYSCSNSYSCSYSYSYSPFLFQFSGLKIQHMMKGALFLILLSYFVFVTHAFSQQIFPANLGSTFGGGSSHEPKYKIEFHQQHSPFHPDDDQESIVIPDKNGQKFICYLPKVEKEKSGKPVIQTNISSMIVGTEKRIKQKMPDELLEVLKGPCFIRQEGWWSYEFCYQKKVRQIHLEDEKVSS*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_311390

• Blastp: Protein OS-9 homolog from Arabidopsis with 52.08% of identity
• Blastx: Protein OS-9 homolog from Arabidopsis with 66.67% of identity
• Eggnog: glycoprotein binding(ENOG410XR8A)
• Kegg: Link to kegg annotations (AT5G35080)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416989.1)
• Pfam: Glucosidase II beta subunit-like protein (PF07915.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;