Protein coding transcript 36243

• Transcript: Ll_transcript_308948
• CDS coordinates: 101-988 (+)
• Peptide sequence: MLLFKKLPYYSSSSLMNSICLSLILHFIVLVFVSCKTTGLVKLPPNVSVPAVLVFGDSIMDTGNNNNNMKTSARCNFAPYGRDLRGGIPTGRFSNGKVPSDLLVEEFGIKEFLPAYLDPNLQPSDLATGVNFASGGAGFDPLTSQVAELYQLGARRIGVFNIPPVGCVPFQRTMAGGIERKCVESYNDAVELLNSKLSKQINSLSQNFPNSRIVYMDVYSPILDIIIDPQKYGYKVGDRGCCGTGTIEVTFLCNHLDSTCSNVLDYVFWDSFHPTESVYRKLVVSILQKYLYQLV*
• ORF Type: complete

Annotations of Ll_transcript_308948

• Blastp: GDSL esterase/lipase EXL1 from Arabidopsis with 38.42% of identity
• Blastx: GDSL esterase/lipase At3g43570 from Arabidopsis with 37.18% of identity
• Eggnog: GDSL esterase lipase(COG3240)
• Kegg: Link to kegg annotations (AT1G75880)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453259.1)
• Pfam: GDSL-like Lipase/Acylhydrolase (PF00657.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;