Protein coding transcript 36258

• Transcript: Ll_transcript_310688
• CDS coordinates: 208-909 (+)
• Peptide sequence: MRIIAQKLRKQMHKRKEEEEKKMEKEREKERIQAGKKLMEAKRIAEEAHRKRYIALKKEEKEEEKKARQKVLQKLEQDKINRRSIHSIPSKVHEPVTSSATAVRENKSLKPVYTTAKVDHLRECLRSLKCNLQGENARARKAFETLLIYVGNVAKNPDEEKYRKIRLSNPVFKERIGNLKDGVEFLELCGFERRGDFLYLPHKKCLERLFIKILENGSTSRFFMKVHFSQIGI*
• ORF Type: complete

Annotations of Ll_transcript_310688

• Blastp: Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase from Danio with 40.62% of identity
• Blastx: Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase from Danio with 40.62% of identity
• Eggnog: Specifically deglycosylates the denatured form of N- linked glycoproteins in the cytoplasm and assists their proteasome-mediated degradation. Cleaves the beta-aspartyl- glucosamine (GlcNAc) of the glycan and the amide side chain of Asn, converting Asn to Asp. Prefers proteins containing high- mannose over those bearing complex type oligosaccharides. Can recognize misfolded proteins in the endoplasmic reticulum that are exported to the cytosol to be destroyed and deglycosylate them, while it has no activity toward native proteins. Deglycosylation is a prerequisite for subsequent proteasome-mediated degradation of some, but not all, misfolded glycoproteins(ENOG410XP69)
• Kegg: Link to kegg annotations (553627)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459744.1)
• Pfam: PUB domain (PF09409.9)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;