Protein coding transcript 36261

• Transcript: Ll_transcript_310699
• CDS coordinates: 383-1051 (+)
• Peptide sequence: MHKRKEEEEKKMEKEREKERIQAGKKLMEAKRIAEEAHRKRYIALKKEEKEEEKKARQKVLQKLEQDKINRRSIHSIPSKVHEPVTSSATAVRENKSLKPVYTTAKVDHLRECLRSLKCNLQGENARARKAFETLLIYVGNVAKNPDEEKYRKIRLSNPVFKERIGNLKDGVEFLELCGFERRGDFLYLPHKKVDTKLLNSAGFVLNSALTNPFFGILSTYD*
• ORF Type: complete

Annotations of Ll_transcript_310699

• Blastp: UBX domain-containing protein 6 from Homo with 44.64% of identity
• Blastx: UBX domain-containing protein 6 from Homo with 44.64% of identity
• Eggnog: alveolar soft part sarcoma chromosome region, candidate 1(ENOG410XQQK)
• Kegg: Link to kegg annotations (80700)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459744.1)
• Pfam: PUB domain (PF09409.9)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;