Transcript | Ll_transcript_310700 |
---|---|
CDS coordinates | 3-770 (+) |
Peptide sequence | QLSLHKLVSYSVLNCGYGRNCDYCNCKYCSRCGNTSVEKAISWLIHHDTDSDIDEMPLVDVDIPIESTESFPISEEMRIIAQKLRKQMHKRKEEEEKKMEKEREKERIQAGKKLMEAKRIAEEAHRKRYIALKKEEKEEEKKARQKVLQKLEQDKINRRSIHSIPSKVHEPVTSSATAVRENKSLKPVYTTAKVDHLRECLRSLKCNLQGENARARKAFETLLIYVGNVAKNPDEEKYRKIRLSNPVFKVGYFFC* |
ORF Type | 5prime_partial |
Blastp | UBX domain-containing protein 1-A from Xenopus with 27.97% of identity |
---|---|
Blastx | - |
Eggnog | - |
Kegg | Link to kegg annotations (443814) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019459744.1) |
Pfam | PUB domain (PF09409.9) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer