| Transcript | Ll_transcript_310704 |
|---|---|
| CDS coordinates | 3-671 (+) |
| Peptide sequence | QLSLHKLVSYSVLNCGYGRNCDYCNCKYCSRCGNTSVEKAISWLIHHDTDSDIDEMPLVDVDIPIESTESFPISEEMRIIAQKLRKQMHKRKEEEEKKMEKEREKERIQAGKKLMEAKRIAEEAHRKRYIALKKEEKEEEKKARQKVLQKLEQDKINRRSIHSIPSKVHEPVTSSATAVRENKSLKPVYTTAKVDHLRECLRSLKCNLQVNGFYLPPSGYSH* |
| ORF Type | 5prime_partial |
| Blastp | UBX domain-containing protein 1 from Danio with 27.02% of identity |
|---|---|
| Blastx | - |
| Eggnog | UBX domain protein(ENOG4111HH6) |
| Kegg | Link to kegg annotations (322073) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019459744.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer