Transcript | Ll_transcript_310704 |
---|---|
CDS coordinates | 3-671 (+) |
Peptide sequence | QLSLHKLVSYSVLNCGYGRNCDYCNCKYCSRCGNTSVEKAISWLIHHDTDSDIDEMPLVDVDIPIESTESFPISEEMRIIAQKLRKQMHKRKEEEEKKMEKEREKERIQAGKKLMEAKRIAEEAHRKRYIALKKEEKEEEKKARQKVLQKLEQDKINRRSIHSIPSKVHEPVTSSATAVRENKSLKPVYTTAKVDHLRECLRSLKCNLQVNGFYLPPSGYSH* |
ORF Type | 5prime_partial |
Blastp | UBX domain-containing protein 1 from Danio with 27.02% of identity |
---|---|
Blastx | - |
Eggnog | UBX domain protein(ENOG4111HH6) |
Kegg | Link to kegg annotations (322073) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019459744.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer