Transcript | Ll_transcript_310705 |
---|---|
CDS coordinates | 3-932 (+) |
Peptide sequence | QLSLHKLVSYSVLNCGYGRNCDYCNCKYCSRCGNTSVEKAISWLIHHDTDSDIDEMPLVDVDIPIESTESFPISEEMRIIAQKLRKQMHKRKEEEEKKMEKEREKERIQAGKKLMEAKRIAEEAHRKRYIALKKEEKEEEKKARQKVLQKLEQDKINRRSIHSIPSKVHEPVTSSATAVRENKSLKPVYTTAKVDHLRECLRSLKCNLQGENARARKAFETLLIYVGNVAKNPDEEKYRKIRLSNPVFKERIGNLKDGVEFLELCGFERRGDFLYLPHKKCLERLFIKILENGSTSRFFMKVHFSQIGI* |
ORF Type | 5prime_partial |
Blastp | UBX domain-containing protein 1 from Silurana with 27.85% of identity |
---|---|
Blastx | Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase from Danio with 40.62% of identity |
Eggnog | UBX domain protein(ENOG4111HH6) |
Kegg | Link to kegg annotations (448372) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019459744.1) |
Pfam | PUB domain (PF09409.9) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer