Transcript | Ll_transcript_310711 |
---|---|
CDS coordinates | 3-932 (+) |
Peptide sequence | QLSLHKLVSYSVLNCGYGRNCDYCNCKYCSRCGNTSVEKAISWLIHHDTDSDIDEMPLVDVDIPIESTESFPISEEMRIIAQKLRKQMHKRKEEEEKKMEKEREKERIQAGKKLMEAKRIAEEAHRKRYIALKKEEKEEEKKARQKVLQKLEQDKINRRSIHSIPSKVHEPVTSSATAVRENKSLKPVYTTAKVDHLRECLRSLKCNLQGENARARKAFETLLIYVGNVAKNPDEEKYRKIRLSNPVFKERIGNLKDGVEFLELCGFERRGDFLYLPHKKVDTKLLNSAGFVLNSALTNPFFGILSTYD* |
ORF Type | 5prime_partial |
Blastp | UBX domain-containing protein 1 from Silurana with 27.85% of identity |
---|---|
Blastx | UBX domain-containing protein 6 from Homo with 44.64% of identity |
Eggnog | UBX domain protein(ENOG4111HH6) |
Kegg | Link to kegg annotations (448372) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019459744.1) |
Pfam | PUB domain (PF09409.9) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer