Protein coding transcript 36271

• Transcript: Ll_transcript_310711
• CDS coordinates: 3-932 (+)
• Peptide sequence: QLSLHKLVSYSVLNCGYGRNCDYCNCKYCSRCGNTSVEKAISWLIHHDTDSDIDEMPLVDVDIPIESTESFPISEEMRIIAQKLRKQMHKRKEEEEKKMEKEREKERIQAGKKLMEAKRIAEEAHRKRYIALKKEEKEEEKKARQKVLQKLEQDKINRRSIHSIPSKVHEPVTSSATAVRENKSLKPVYTTAKVDHLRECLRSLKCNLQGENARARKAFETLLIYVGNVAKNPDEEKYRKIRLSNPVFKERIGNLKDGVEFLELCGFERRGDFLYLPHKKVDTKLLNSAGFVLNSALTNPFFGILSTYD*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_310711

• Blastp: UBX domain-containing protein 1 from Silurana with 27.85% of identity
• Blastx: UBX domain-containing protein 6 from Homo with 44.64% of identity
• Eggnog: UBX domain protein(ENOG4111HH6)
• Kegg: Link to kegg annotations (448372)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459744.1)
• Pfam: PUB domain (PF09409.9)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;