Protein coding transcript 36280

• Transcript: Ll_transcript_310696
• CDS coordinates: 3-674 (+)
• Peptide sequence: QLSLHKLVSYSVLNCGYGRNCDYCNCKYCSRCGNTSVEKAISWLIHHDTDSDIDEMPLVDVDIPIESTESFPISEEMRIIAQKLRKQMHKRKEEEEKKMEKEREKERIQAGKKLMEAKRIAEEAHRKRYIALKKEEKEEEKKARQKVLQKLEQDKINRRSIHSIPSKVHEPVTSSATAVRENKSLKPVYTTAKVDHLRECLRSLKCNLQEMLPRILMRKNIGR*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_310696

• Blastp: UBX domain-containing protein 1 from Danio with 31.03% of identity
• Blastx: Plant UBX domain-containing protein 2 from Arabidopsis with 53.66% of identity
• Eggnog: UBX domain protein(ENOG4111HH6)
• Kegg: Link to kegg annotations (322073)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459744.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;