Transcript | Ll_transcript_384513 |
---|---|
CDS coordinates | 2-307 (+) |
Peptide sequence | LFSKTWIEVSGSSARDVAKQLKEQQMVMPGHRESNLQKELNRYIPTAAAFGGICIGALTVLADFMGAIGSGTGILLAVTIIYQYFETFEKERASELGFFGF* |
ORF Type | 5prime_partial |
Blastp | Protein transport protein Sec61 subunit alpha from Dictyostelium with 85.87% of identity |
---|---|
Blastx | Protein transport protein Sec61 subunit alpha from Dictyostelium with 85.87% of identity |
Eggnog | The central subunit of the protein translocation channel SecYEG. Consists of two halves formed by TMs 1-5 and 6-10. These two domains form a lateral gate at the front which open onto the bilayer between TMs 2 and 7, and are clamped together by SecE at the back. The channel is closed by both a pore ring composed of hydrophobic SecY resides and a short helix (helix 2A) on the extracellular side of the membrane which forms a plug. The plug probably moves laterally to allow the channel to open. The ring and the pore may move independently (By similarity)(COG0201) |
Kegg | Link to kegg annotations (DDB_G0278885) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_004491760.1) |
Pfam | SecY translocase (PF00344.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer