Transcript | Ll_transcript_385382 |
---|---|
CDS coordinates | 1190-1747 (+) |
Peptide sequence | MQTSAFGKSKGLLKTLTEGNWSDAFDGLSISLLLTTNPAIQYTVFDQLKHRVLTNKPNKDDKTKSPAALSAFMAFLIGAVSKSIATVITYPAIRCKVIIQAADPDESTSETKVKSQKTLSSVLYGIWKSEGILGFFKGLHAQILKTVLSSALLLMIKEKISATTWVLILAAKKYLLLQRGKIKNV* |
ORF Type | complete |
Blastp | Peroxisomal adenine nucleotide carrier 1 from Soja with 83.24% of identity |
---|---|
Blastx | Peroxisomal adenine nucleotide carrier 1 from Soja with 83.96% of identity |
Eggnog | peroxisomal membrane protein(ENOG410ZNC0) |
Kegg | Link to kegg annotations (100301879) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019433411.1) |
Pfam | Mitochondrial carrier protein (PF00153.26) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer