| Transcript | Ll_transcript_385387 |
|---|---|
| CDS coordinates | 1190-1504 (+) |
| Peptide sequence | MQTSAFGKSKGLLKTLTEGNWSDAFDGLSISLLLTTNPAIQYTVFDQLKHRVLTNKPNKDDKTKSPAALSAFMAFLIGAVSKSIATVITYPAIRCIIAPSVFDT* |
| ORF Type | complete |
| Blastp | Peroxisomal adenine nucleotide carrier 1 from Soja with 76.92% of identity |
|---|---|
| Blastx | Peroxisomal adenine nucleotide carrier 1 from Soja with 89.19% of identity |
| Eggnog | peroxisomal membrane protein(ENOG410ZNC0) |
| Kegg | Link to kegg annotations (100301879) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019433411.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer