Protein coding transcript 36442

• Transcript: Ll_transcript_385394
• CDS coordinates: 103-426 (+)
• Peptide sequence: MMQSRIRRSVSLFRRSLLHSNNAKYSSSSSSYGVDEILDNEVLVEGIGYTRMAILNRPSALNAINTNMATRLHQFYRTWEDNSHIGFLMIKVLMYIFYILFTFNYSY*
• ORF Type: complete

Annotations of Ll_transcript_385394

• Blastp: 3-hydroxyisobutyryl-CoA hydrolase-like protein 1, mitochondrial from Arabidopsis with 57.14% of identity
• Blastx: 3-hydroxyisobutyryl-CoA hydrolase-like protein 1, mitochondrial from Arabidopsis with 57.14% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AT3G60510)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413106.1)
• Pfam: Enoyl-CoA hydratase/isomerase (PF16113.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;