Transcript | Ll_transcript_385832 |
---|---|
CDS coordinates | 96-527 (+) |
Peptide sequence | MGGVSDLPNWDELIPDALGVIFTKLSLQERVTVIPRVCKSWAKAVSEPYCWQEIDINEWSNGCKPDKLDRMLEMLITRSNGSLKKLSVSDVQTERIFTFIAENACSLRTLRLPRCSLSDSNVEHIARRLSMISFLDVSYCIKIG |
ORF Type | 3prime_partial |
Blastp | F-box protein FBW2 from Arabidopsis with 61.31% of identity |
---|---|
Blastx | F-box protein FBW2 from Arabidopsis with 61.31% of identity |
Eggnog | NA(ENOG410YQ9V) |
Kegg | Link to kegg annotations (AT4G08980) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019417875.1) |
Pfam | F-box domain (PF00646.32) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer