Protein coding transcript 36453

• Transcript: Ll_transcript_385845
• CDS coordinates: 1307-1849 (+)
• Peptide sequence: MISFLDVSYCIKIGASALEIIGKNCKLLEGLCRNMHPLDTAGKPLQDDEAYAIATTMPKLKHLELAYNLISTCGVLKILSYCPKLEFLDQRGCWGVTLDNMYVKQKFPKLKVLGPLVLDTYGNDAWDDYSDISDSSEWDFADGGMDEYDVDDSDSNDGMWDDEGRLDDELQFRFYEGIEDA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_385845

• Blastp: F-box protein FBW2 from Arabidopsis with 55.62% of identity
• Blastx: F-box protein FBW2 from Arabidopsis with 50.93% of identity
• Eggnog: NA(ENOG410YQ9V)
• Kegg: Link to kegg annotations (AT4G08980)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417876.1)
• Pfam: Leucine Rich repeat (PF13516.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;