Protein coding transcript 36495

• Transcript: Ll_transcript_385620
• CDS coordinates: 265-828 (+)
• Peptide sequence: MGNKLGRRRQVVDEKYTRPQGLYNHKDVDHKKLRKLICESKLAPCYPGDDDCTYDLEECPICFLYYPSLNRSRCCMKSICTECFLKMKVPNSTRPSQCPFCKTPNYAVEYRGVKSKEEKGLEQIEEQRVIEAKIRMRQQQLLDEEERMHKRQEISFSDGNVTFTDVEYSSNAGSRSLPFWALSVFMCH
• ORF Type: 3prime_partial

Annotations of Ll_transcript_385620

• Blastp: Protein SIP5 from Eremothecium with 40.43% of identity
• Blastx: Protein SIP5 from Eremothecium with 40.43% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AGOS_ADR255W)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449248.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;