Protein coding transcript 36496

• Transcript: Ll_transcript_385621
• CDS coordinates: 818-1567 (+)
• Peptide sequence: MGNKLGRRRQVVDEKYTRPQGLYNHKDVDHKKLRKLICESKLAPCYPGDDDCTYDLEECPICFLYYPSLNRSRCCMKSICTECFLKMKVPNSTRPSQCPFCKTPNYAVEYRGVKSKEEKGLEQIEEQRVIEAKIRMRQQQLLDEEERMHKRQEISFSDGNVTFTDVEYSSNAVAAASVSVVEGEEIVSSQDSSATSMVRPPPSTRSNRDDDFDIDLEDIMVMEAIWLSIQVKAYILICLAINISSLNFG*
• ORF Type: complete

Annotations of Ll_transcript_385621

• Blastp: Protein SIP5 from Eremothecium with 40.43% of identity
• Blastx: Protein SIP5 from Eremothecium with 40.43% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AGOS_ADR255W)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449248.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;