Transcript | Ll_transcript_385635 |
---|---|
CDS coordinates | 265-1014 (+) |
Peptide sequence | MGNKLGRRRQVVDEKYTRPQGLYNHKDVDHKKLRKLICESKLAPCYPGDDDCTYDLEECPICFLYYPSLNRSRCCMKSICTECFLKMKVPNSTRPSQCPFCKTPNYAVEYRGVKSKEEKGLEQIEEQRVIEAKIRMRQQQLLDEEERMHKRQEISFSDGNVTFTDVEYSSNAVAAASVSVVEGEEIVSSQDSSATSMVRPPPSTRSNRDDDFDIDLEDIMVMEAIWLSIQVKAYILICLAINISSLNFG* |
ORF Type | complete |
Blastp | Protein SIP5 from Eremothecium with 40.43% of identity |
---|---|
Blastx | Protein SIP5 from Eremothecium with 40.43% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (AGOS_ADR255W) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019449248.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer