Protein coding transcript 366

• Transcript: Ll_transcript_502424
• CDS coordinates: 2-370 (+)
• Peptide sequence: SAKNKALKRGVKECVKAIRKSPAGIPGATDSPSGIVVLAADISPMDVISHIPVLCEDHSIPYIYVPSRAELGAAGSTKRPTSVVMITPKQGKGAEKESEEEWKEAYAELNKLAIKMGQTVKV*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_502424

• Blastp: H/ACA ribonucleoprotein complex subunit 2 from Saccharomyces with 57.27% of identity
• Blastx: H/ACA ribonucleoprotein complex subunit 2 from Saccharomyces with 62.5% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (YDL208W)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020228875.1)
• Pfam: Ribosomal protein L7Ae/L30e/S12e/Gadd45 family (PF01248.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;