Protein coding transcript 36604

• Transcript: Ll_transcript_385791
• CDS coordinates: 168-671 (+)
• Peptide sequence: MAAITLKPYSLLRPSNPLLHKPPSPTFLRTAFSHSTIMLKSRRRKINTLTVCVLMDDPKQDEEDQQQEEPQVVVVSERVTEKLARKKSERFTYLVAAVMSSFGITSLSILAVYYRFSWQLEGGEIPWPEMFGTFAFSMGAAVGMEFWARWAHKALWHASLWHMHEVC*
• ORF Type: complete

Annotations of Ll_transcript_385791

• Blastp: Beta-carotene hydroxylase 2, chloroplastic from Capsicum with 59.38% of identity
• Blastx: Beta-carotene hydroxylase 2, chloroplastic from Capsicum with 59.38% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (CAA70888)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442123.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;