Transcript | Ll_transcript_385793 |
---|---|
CDS coordinates | 168-671 (+) |
Peptide sequence | MAAITLKPYSLLRPSNPLLHKPPSPTFLRTAFSHSTIMLKSRRRKINTLTVCVLMDDPKQDEEDQQQEEPQVVVVSERVTEKLARKKSERFTYLVAAVMSSFGITSLSILAVYYRFSWQLEGGEIPWPEMFGTFAFSMGAAVGMEFWARWAHKALWHASLWHMHEVC* |
ORF Type | complete |
Blastp | Beta-carotene hydroxylase 2, chloroplastic from Capsicum with 59.38% of identity |
---|---|
Blastx | Beta-carotene 3-hydroxylase, chloroplastic from Gentiana with 87.91% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (CAA70888) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019442123.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer